(data stored in ACNUC29543 zone)

EMBL: CP000521.PE692

CP000521.PE692       Location/Qualifiers
FT   CDS             complement(782608..783618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0659"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0659"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11108"
FT                   /protein_id="ABO11108.1"
FT                   /translation="MVLVEALWGKWRALTIDLDKGVDAEKFDALLSHSIETRQNIQQSM
FT                   LSSFVSEIQPNYDPKQTIPWVLSLGTRNRSNTSGRQVCVECLKSRENPPYFRLMWRMGW
FT                   HCSCDRHQVSLIDHCPECGVTLQAFKTDLEHGCLAICTACGFDLRHCKQSQNINLNSLN
FT                   FQNKADQVLKQKVGFYNQSIITSQEWFEIARVWLSEIRFLINTSNKNVIQLFESFDVNL
FT                   HLSHPVTPLAFEYLNTQERIVLLSILDQIMDIPCDLLVQRSNEYGISHANFWDKRKKLP
FT                   VQLQQMKDLMIKPTRRYPVSRAAITVTKPKSKASVQRQWLNLLRRSNNSGARLID"
     MVLVEALWGK WRALTIDLDK GVDAEKFDAL LSHSIETRQN IQQSMLSSFV SEIQPNYDPK        60
     QTIPWVLSLG TRNRSNTSGR QVCVECLKSR ENPPYFRLMW RMGWHCSCDR HQVSLIDHCP       120
     ECGVTLQAFK TDLEHGCLAI CTACGFDLRH CKQSQNINLN SLNFQNKADQ VLKQKVGFYN       180
     QSIITSQEWF EIARVWLSEI RFLINTSNKN VIQLFESFDV NLHLSHPVTP LAFEYLNTQE       240
     RIVLLSILDQ IMDIPCDLLV QRSNEYGISH ANFWDKRKKL PVQLQQMKDL MIKPTRRYPV       300
     SRAAITVTKP KSKASVQRQW LNLLRRSNNS GARLID                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page