(data stored in ACNUC29543 zone)

EMBL: CP000521.PE701

CP000521.PE701       Location/Qualifiers
FT   CDS             790522..791967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0666"
FT                   /product="TrbL/VirB6 plasmid conjugal transfer protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0666"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11115"
FT                   /protein_id="ABO11115.1"
FT                   /translation="MIIEVVAMRKKIALGGLMMVATMVLAEPAMAQELSSSGVMNDVLK
FT                   RFHDAAATWGPAIESAASRLFWTLVVISMVWTFGMMALRKADIGEFFAEFVRFTIFTGF
FT                   FWWLLTNANQGMNIAGTIVQSLQTLGAQAGGLSNSNLGPSSILDLGFELYNRTVQATSE
FT                   LGWRQMATALVMELMALAVLFVLALIAVNLLLLLASAWILLYAGVFFLGFGGSRWTSDM
FT                   AINYYKTVLGLAAQLMAMVLLVAIGKEFINHYYTQISENMASQELAVMLVISVTCLCCQ
FT                   KVPPMISGLVSGGGIGAAGGIGNFGAGAAVGAAVTAASMATGGAALAGKAVMGAAAGAA
FT                   GGASALQAAFQKASASMETGGDMSSMGSVVSSGGNGGGEAGTAGSSPFAQAAGFGDSGS
FT                   SSSGGGFAKAAKLATGTASELAKGVGSQVKQGFQERVSETTGGKLAASIRESMEPKEAS
FT                   QSGQFEGNSLGADSGPDSNEVRS"
     MIIEVVAMRK KIALGGLMMV ATMVLAEPAM AQELSSSGVM NDVLKRFHDA AATWGPAIES        60
     AASRLFWTLV VISMVWTFGM MALRKADIGE FFAEFVRFTI FTGFFWWLLT NANQGMNIAG       120
     TIVQSLQTLG AQAGGLSNSN LGPSSILDLG FELYNRTVQA TSELGWRQMA TALVMELMAL       180
     AVLFVLALIA VNLLLLLASA WILLYAGVFF LGFGGSRWTS DMAINYYKTV LGLAAQLMAM       240
     VLLVAIGKEF INHYYTQISE NMASQELAVM LVISVTCLCC QKVPPMISGL VSGGGIGAAG       300
     GIGNFGAGAA VGAAVTAASM ATGGAALAGK AVMGAAAGAA GGASALQAAF QKASASMETG       360
     GDMSSMGSVV SSGGNGGGEA GTAGSSPFAQ AAGFGDSGSS SSGGGFAKAA KLATGTASEL       420
     AKGVGSQVKQ GFQERVSETT GGKLAASIRE SMEPKEASQS GQFEGNSLGA DSGPDSNEVR       480
     S                                                                       481
//

If you have problems or comments...

PBIL Back to PBIL home page