(data stored in ACNUC29543 zone)

EMBL: CP000521.PE705

CP000521.PE705       Location/Qualifiers
FT   CDS             794032..794532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0670"
FT                   /product="protein tyrosine phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0670"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11118"
FT                   /protein_id="ABO11118.1"
FT                   /translation="MCRKVCSKAPALLGVSAFDGGRVFKSPMRRDRLTRPHRTHFAGGV
FT                   VADGDDEVHLRCVGRGVLVPALAAQILGRVIHRLHLFDGEGIDLAGWVTAGAVGAEAPL
FT                   PHRVDESFGHDAARRIAGAEDEDVIDSFGHDVSLSGSGWGAMAMDERSVASSMTWPAAF
FT                   RSE"
     MCRKVCSKAP ALLGVSAFDG GRVFKSPMRR DRLTRPHRTH FAGGVVADGD DEVHLRCVGR        60
     GVLVPALAAQ ILGRVIHRLH LFDGEGIDLA GWVTAGAVGA EAPLPHRVDE SFGHDAARRI       120
     AGAEDEDVID SFGHDVSLSG SGWGAMAMDE RSVASSMTWP AAFRSE                      166
//

If you have problems or comments...

PBIL Back to PBIL home page