(data stored in ACNUC29543 zone)

EMBL: CP000521.PE713

CP000521.PE713       Location/Qualifiers
FT   CDS             814283..814621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0683"
FT                   /product="putative sigma(54) modulation protein RpoX"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0683"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11127"
FT                   /protein_id="ABO11127.2"
FT                   /translation="MQITIRGHHLAITPAIEENIKAKFNQLTKHLDQVNSMQIKLTKDH
FT                   QIDKRSHKGSSNHVAEAIVRLPGIELFAQATADDMYTSIKKLTEKLKKQLLKYRKMQCT
FT                   YSQVAVSI"
     MQITIRGHHL AITPAIEENI KAKFNQLTKH LDQVNSMQIK LTKDHQIDKR SHKGSSNHVA        60
     EAIVRLPGIE LFAQATADDM YTSIKKLTEK LKKQLLKYRK MQCTYSQVAV SI               112
//

If you have problems or comments...

PBIL Back to PBIL home page