(data stored in ACNUC29543 zone)

EMBL: CP000521.PE714

CP000521.PE714       Location/Qualifiers
FT   CDS             814760..815011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0684"
FT                   /product="putative toluene tolerance protein Ttg2F"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0684"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11128"
FT                   /protein_id="ABO11128.1"
FT                   /translation="MNSEQLTQILKEAFPEAEVVVSGQAGKFDLRIVDDQFEGKRTVAR
FT                   QQAVYAPLNTYIASGEVHAVTIRAMTKDEWRKASLFGA"
     MNSEQLTQIL KEAFPEAEVV VSGQAGKFDL RIVDDQFEGK RTVARQQAVY APLNTYIASG        60
     EVHAVTIRAM TKDEWRKASL FGA                                                83
//

If you have problems or comments...

PBIL Back to PBIL home page