(data stored in ACNUC29543 zone)

EMBL: CP000521.PE731

CP000521.PE731       Location/Qualifiers
FT   CDS             832967..834010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0701"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0701"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11145"
FT                   /protein_id="ABO11145.1"
FT                   /translation="MWLFLGSRRSLQIVHPSILQLIVWGVLGGCTNSLYSWLVAGQIGD
FT                   FNSQGLIGYALWPFIALIVGIFLSQRINQPRLMLVPALLWLVLDTNILLIQCLIQYLGS
FT                   NGYLNFIPDAIYNGILPGLFVALFVWQSLAVIWVFSRELKWPWWERALVMVATIATMVV
FT                   WQLSVKDQPIWKVEDSPPTFAEDAFYAQSKLLHDALEQVQYGELAKSHWYFLGVAGDSY
FT                   QDVFKSEVVRIKEQFDTRFGTVGRSMMLVNNPDTRTEIPIASKTSIELALRRMGQQMNR
FT                   DSDVLFLYMTSHGEQNHFEIENAPLDLGQVDPKWLRETLDKAGIRWRVIVISACYSGKF
FT                   YSGVTVT"
     MWLFLGSRRS LQIVHPSILQ LIVWGVLGGC TNSLYSWLVA GQIGDFNSQG LIGYALWPFI        60
     ALIVGIFLSQ RINQPRLMLV PALLWLVLDT NILLIQCLIQ YLGSNGYLNF IPDAIYNGIL       120
     PGLFVALFVW QSLAVIWVFS RELKWPWWER ALVMVATIAT MVVWQLSVKD QPIWKVEDSP       180
     PTFAEDAFYA QSKLLHDALE QVQYGELAKS HWYFLGVAGD SYQDVFKSEV VRIKEQFDTR       240
     FGTVGRSMML VNNPDTRTEI PIASKTSIEL ALRRMGQQMN RDSDVLFLYM TSHGEQNHFE       300
     IENAPLDLGQ VDPKWLRETL DKAGIRWRVI VISACYSGKF YSGVTVT                     347
//

If you have problems or comments...

PBIL Back to PBIL home page