(data stored in ACNUC29543 zone)

EMBL: CP000521.PE737

CP000521.PE737       Location/Qualifiers
FT   CDS             837595..837990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3560"
FT                   /old_locus_tag="AS1_3560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3560"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89985"
FT                   /protein_id="ABS89985.2"
FT                   /translation="MTLQHLRKYAWFVFLMTLVIGWSGVSIAQTPMQHDLHTMPCHSEQ
FT                   MKHHSMHIQADEQTTCHQSMAQVSHQHGEHCQDCNPVHCQMVNLALQQAVPDIESSFIP
FT                   IPSQFSSIYQAQHLAGYWQEILRPPKA"
     MTLQHLRKYA WFVFLMTLVI GWSGVSIAQT PMQHDLHTMP CHSEQMKHHS MHIQADEQTT        60
     CHQSMAQVSH QHGEHCQDCN PVHCQMVNLA LQQAVPDIES SFIPIPSQFS SIYQAQHLAG       120
     YWQEILRPPK A                                                            131
//

If you have problems or comments...

PBIL Back to PBIL home page