(data stored in ACNUC29543 zone)

EMBL: CP000521.PE742

CP000521.PE742       Location/Qualifiers
FT   CDS             842213..842692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0711"
FT                   /product="Methylated-DNA-(protein)-cysteine
FT                   S-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0711"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11155"
FT                   /protein_id="ABO11155.2"
FT                   /translation="MLLSYKYINSPVGQLKLVANENALVAVLWDNENPKRVRLAELVEQ
FT                   LEHPVLLKTEQQLQEYFEGKRREFTLPLDFEGTAFQKQVWAALLTIPYGETRSYKDIAV
FT                   QIGNEKAVRAVGAANGKNPISIIAPCHRVIGAGGALVGFAGGLDKKDILLRLEQK"
     MLLSYKYINS PVGQLKLVAN ENALVAVLWD NENPKRVRLA ELVEQLEHPV LLKTEQQLQE        60
     YFEGKRREFT LPLDFEGTAF QKQVWAALLT IPYGETRSYK DIAVQIGNEK AVRAVGAANG       120
     KNPISIIAPC HRVIGAGGAL VGFAGGLDKK DILLRLEQK                              159
//

If you have problems or comments...

PBIL Back to PBIL home page