(data stored in ACNUC29543 zone)

EMBL: CP000521.PE752

CP000521.PE752       Location/Qualifiers
FT   CDS             complement(855091..856497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0725"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0725"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11165"
FT                   /protein_id="ABO11165.2"
FT                   /translation="MHDVIVIGGGNAALCAALTARESGASVLVIEAAPKEWRGGNSQHT
FT                   RNLRCMHDAPQDVLVDAYPEEEYWQDLLKVTAGKTNEHLARLVIRSTATCRDWMRKHGV
FT                   NFQPPLSGALHVARTNAFFMGGGKALINAYYRSAEKLGIEILYNTKIKDLKLNQGHFEA
FT                   AIAEDGRVFKAKSCVLAAGGFESNLEWLREAWGQNENGEWPADNFIIRGTRFNQGNLLK
FT                   FMIDQGADIIGDPSQSHCVAVDARAPLYDGGICTRIDCVSLGIVVNNKAERFYDEGEDF
FT                   WPKRYAIWGRLVAKQPQQIAYSIIDSKAIGRFMPPVFAGVKANSIQELAEKIGLDAKTL
FT                   CHTVEEFNQACVQGTFNHTVLDDCTTENIIPNKTHWAVPLDQPPFYAYALKPGITFTYL
FT                   GLKVEDDAAVRFNNKASRNLFVAGEMMAGNVLGQGYTAGVGMSIGTTFGRIAGKNAAHY
FT                   ALSQGVEHEC"
     MHDVIVIGGG NAALCAALTA RESGASVLVI EAAPKEWRGG NSQHTRNLRC MHDAPQDVLV        60
     DAYPEEEYWQ DLLKVTAGKT NEHLARLVIR STATCRDWMR KHGVNFQPPL SGALHVARTN       120
     AFFMGGGKAL INAYYRSAEK LGIEILYNTK IKDLKLNQGH FEAAIAEDGR VFKAKSCVLA       180
     AGGFESNLEW LREAWGQNEN GEWPADNFII RGTRFNQGNL LKFMIDQGAD IIGDPSQSHC       240
     VAVDARAPLY DGGICTRIDC VSLGIVVNNK AERFYDEGED FWPKRYAIWG RLVAKQPQQI       300
     AYSIIDSKAI GRFMPPVFAG VKANSIQELA EKIGLDAKTL CHTVEEFNQA CVQGTFNHTV       360
     LDDCTTENII PNKTHWAVPL DQPPFYAYAL KPGITFTYLG LKVEDDAAVR FNNKASRNLF       420
     VAGEMMAGNV LGQGYTAGVG MSIGTTFGRI AGKNAAHYAL SQGVEHEC                    468
//

If you have problems or comments...

PBIL Back to PBIL home page