(data stored in ACNUC29543 zone)

EMBL: CP000521.PE757

CP000521.PE757       Location/Qualifiers
FT   CDS             861368..862753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0730"
FT                   /product="putative long-chain fatty acid transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0730"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11170"
FT                   /protein_id="ABO11170.2"
FT                   /translation="MNFVVNKKIFILGIASICTSTLHAAAFDKTGQSVAAFLQPGNYFE
FT                   ASLGITDADLSGVESGTNPSHHSILDIANTDYRPTAALKLQLAPQYSFGLLYDQPFGAD
FT                   TEYSGVNGFVATPKDTVMLPGITTTGLASATLGHAPTGNAKSEFDIQNLSFILGYQPTK
FT                   NWNLYAGPVYQTFKSQVELRGNVFSLYNGYDFHTKTVSDLGWLAGLAYQIPEKAVKVSL
FT                   TYRSAITHKVNATENAPLIDMLSTQQGRDLVNQHLDFMISIGQMTPQKKAYLNQIIANL
FT                   PEQEDTGTTKFKSPDSVNLEFQTGLRQGTLLFGSLRWVNWSDLALQPYRFGEISKVVGV
FT                   LSTPSRPEGFNLVRYYDDQWSLNLGLGQRFSPKWLGSVSVGWDSGAGDKVSTGGPTKGY
FT                   YNLGVGAQYSPTSRYFISGGVKYYWLGDAKAQLGAQAGSDYYVGEFKDNHSVSYGLKIG
FT                   YKF"
     MNFVVNKKIF ILGIASICTS TLHAAAFDKT GQSVAAFLQP GNYFEASLGI TDADLSGVES        60
     GTNPSHHSIL DIANTDYRPT AALKLQLAPQ YSFGLLYDQP FGADTEYSGV NGFVATPKDT       120
     VMLPGITTTG LASATLGHAP TGNAKSEFDI QNLSFILGYQ PTKNWNLYAG PVYQTFKSQV       180
     ELRGNVFSLY NGYDFHTKTV SDLGWLAGLA YQIPEKAVKV SLTYRSAITH KVNATENAPL       240
     IDMLSTQQGR DLVNQHLDFM ISIGQMTPQK KAYLNQIIAN LPEQEDTGTT KFKSPDSVNL       300
     EFQTGLRQGT LLFGSLRWVN WSDLALQPYR FGEISKVVGV LSTPSRPEGF NLVRYYDDQW       360
     SLNLGLGQRF SPKWLGSVSV GWDSGAGDKV STGGPTKGYY NLGVGAQYSP TSRYFISGGV       420
     KYYWLGDAKA QLGAQAGSDY YVGEFKDNHS VSYGLKIGYK F                           461
//

If you have problems or comments...

PBIL Back to PBIL home page