(data stored in ACNUC29543 zone)

EMBL: CP000521.PE76

CP000521.PE76        Location/Qualifiers
FT   CDS             83782..85488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0070"
FT                   /product="D-lactate dehydrogenase NADH independent,
FT                   FAD-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10565"
FT                   /protein_id="ABO10565.2"
FT                   /translation="MQTFSPQAVIEHLQNIVGRSYVLTDDQSTRQYRQGRRFGEGKVLA
FT                   VVVPGTLLEQWQVLQAAIEADCIVIMQAANTGLTGGSTPYGDDYDRPVLVMSTRRLKGI
FT                   QVIHDGKQVICLPGATLDNLEQILKGYNREPHSVIGSSCIGASVLGGVCNNSGGALVRR
FT                   GPAYTELALYAQVNAAGQLELVNHLGVNLGSTPEEILTRLEKQQYQAVDILDDNEKQAS
FT                   DHRYAHDVTQVDEDTPARFNADPSRLFEASGSAGKVCVFAVRLDTYEKVESSVFYIGSN
FT                   DADDLTAIRRYLLTSLPSLPIAGEYIHRDAYLIGEKYGKDTFLFIEKFGTANVPKAFAM
FT                   KDKVDGFLEKFKIKGLTDQILQAITFFLPSHLPKRMTEYRDRYEHHLVLRVENNSKAQT
FT                   EQFLKEYFAVHQSGNYFVCSEEEGRKAFLHRFAIAGAAIRYRDTHRSEVEDIVALDIAL
FT                   RRNDREWVEQLPAEMEKKIIHKLYYGHFFCHVFHQDYILKKGNDPLEMEHQMWKLLDAR
FT                   RAEYPAEHNVGHLYIAKPALANFYQKLDPTNSFNVGIGHTSKLKYWGKAKS"
     MQTFSPQAVI EHLQNIVGRS YVLTDDQSTR QYRQGRRFGE GKVLAVVVPG TLLEQWQVLQ        60
     AAIEADCIVI MQAANTGLTG GSTPYGDDYD RPVLVMSTRR LKGIQVIHDG KQVICLPGAT       120
     LDNLEQILKG YNREPHSVIG SSCIGASVLG GVCNNSGGAL VRRGPAYTEL ALYAQVNAAG       180
     QLELVNHLGV NLGSTPEEIL TRLEKQQYQA VDILDDNEKQ ASDHRYAHDV TQVDEDTPAR       240
     FNADPSRLFE ASGSAGKVCV FAVRLDTYEK VESSVFYIGS NDADDLTAIR RYLLTSLPSL       300
     PIAGEYIHRD AYLIGEKYGK DTFLFIEKFG TANVPKAFAM KDKVDGFLEK FKIKGLTDQI       360
     LQAITFFLPS HLPKRMTEYR DRYEHHLVLR VENNSKAQTE QFLKEYFAVH QSGNYFVCSE       420
     EEGRKAFLHR FAIAGAAIRY RDTHRSEVED IVALDIALRR NDREWVEQLP AEMEKKIIHK       480
     LYYGHFFCHV FHQDYILKKG NDPLEMEHQM WKLLDARRAE YPAEHNVGHL YIAKPALANF       540
     YQKLDPTNSF NVGIGHTSKL KYWGKAKS                                          568
//

If you have problems or comments...

PBIL Back to PBIL home page