(data stored in ACNUC29543 zone)

EMBL: CP000521.PE767

CP000521.PE767       Location/Qualifiers
FT   CDS             complement(873036..874331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0740"
FT                   /product="putative phage related protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0740"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11180"
FT                   /protein_id="ABO11180.2"
FT                   /translation="MDTKKKGDIFENFVFDYFSALIQKGYMGLNPSHTKIYKQKKYYSK
FT                   DREDYIIFDVAIEVFLFDQKEPYLVILIECKNYEKNVPVDDIEEFSTKVSQVGKHYTKA
FT                   ICITKNGFQKGALNVAKNRKIGLWRITANDNHEVIFNRTINRIKNNDEIISNALTSENL
FT                   QDISATNIFIQTPLRFTSIPKDLIYDFLSLQKDVSPKEFFTQHRVNSYSKTIPYKSKKE
FT                   LSILAENLFDKFYKNDEIDLNEIINTLGYKLIEIDTPEHPNIIGKLETKLKTITIFGVG
FT                   FYSQHQINFAKAHEIAHIFLNHSKYIISENFSPAMESHSIDIEITQNIDRLEFQANYFA
FT                   GCLLLPENRLKATLNYYLRLYGIRNRGFSPLYIDSQPCNFENYSRIILPMTGIFNVSQE
FT                   TMKIRLTELGLAQFAFQPTSTHKVTRSYIDRF"
     MDTKKKGDIF ENFVFDYFSA LIQKGYMGLN PSHTKIYKQK KYYSKDREDY IIFDVAIEVF        60
     LFDQKEPYLV ILIECKNYEK NVPVDDIEEF STKVSQVGKH YTKAICITKN GFQKGALNVA       120
     KNRKIGLWRI TANDNHEVIF NRTINRIKNN DEIISNALTS ENLQDISATN IFIQTPLRFT       180
     SIPKDLIYDF LSLQKDVSPK EFFTQHRVNS YSKTIPYKSK KELSILAENL FDKFYKNDEI       240
     DLNEIINTLG YKLIEIDTPE HPNIIGKLET KLKTITIFGV GFYSQHQINF AKAHEIAHIF       300
     LNHSKYIISE NFSPAMESHS IDIEITQNID RLEFQANYFA GCLLLPENRL KATLNYYLRL       360
     YGIRNRGFSP LYIDSQPCNF ENYSRIILPM TGIFNVSQET MKIRLTELGL AQFAFQPTST       420
     HKVTRSYIDR F                                                            431
//

If you have problems or comments...

PBIL Back to PBIL home page