(data stored in ACNUC29543 zone)

EMBL: CP000521.PE769

CP000521.PE769       Location/Qualifiers
FT   CDS             875353..878292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0742"
FT                   /product="iron-regulated protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0742"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11182"
FT                   /protein_id="ABO11182.2"
FT                   /translation="MGSSLIIQANELYSTVNDLNSAISQGDGKGIDQQIAQLSLISTGL
FT                   GFTIEFAKIAKSPEAVAGLTGLKYQVDATLTGAALTQAMINIDQGNYSGAIANTLAAMS
FT                   TATGLVALAVDKPGLSTALNGLSGFLGASSNVAEKGPQIADALANALSEIQKMQHDGTF
FT                   PELDPGLMAGFAGEVLEGWSKEFYSWFPDDWNPWKNIDRNSDGVKKYHIYDPVVLDLDG
FT                   DGIETIAANKWAGVLFDHDNDGIRTSTGWVGSDDGILVLDRNGDGVINDGSELFGDSVT
FT                   LKDGSQASNGYAALAEFDSNGDGKVNAEDTNFEQLKVWRDLNQDGVSQTNELFGLTELG
FT                   IQSLNLNHTNTDTALGNDNILAQTGSFETLDGQSHIMGDVNFSFNSIYSSFNNAIELTA
FT                   EQQQAANLQGAGRVRDLREAAALSPELAETLKNYSNAETKAEQYDLLDQLILNWAKTDP
FT                   DFKEANEVRMVSWVKTANEGIALTPGQAAIVTLAAPLSKESQAMLDKIHHILPILDAFS
FT                   GSKPSQIYYENEADIKNVFNIINNAYVSLKEGIYTGLLYQTRLDDYLAEIELNLQATDP
FT                   TELFNYSGIQEKLEQIFIINPEKAFTDLSDLVNYHPDILTNWLPEGKTLLIQFLNEVIE
FT                   QGLWDDLASKVDLKILEQSGFIIGTKLDDTLNGTKNNDTLNGGWGNDKLNGGAGQDTLI
FT                   GGSGNAVMTGGDYEKDIYIFQSGHGQDIINDKSYDWTNLQYFNDVKFEGANFTDAQFLR
FT                   VGNDLVIKAFGTDDSVSFKNYLNDNDSYSRDFNFIFADKTLTTADVMNIVIPLNGTDGN
FT                   DVQNGWKGKDNLLGSLGDDTLNGLAGDDWLEGGAGNDILNGGEGNDLLEGGAGNDTLTG
FT                   GIGADTAIFKILAGFGNDATGGNGVDTWSDFNISQGDKINISELIIGPASKENLNQFVS
FT                   FEKSGSTVTLSLDRDGNDINYSATKLLILNNQTNVNSLNDLIKADVFIV"
     MGSSLIIQAN ELYSTVNDLN SAISQGDGKG IDQQIAQLSL ISTGLGFTIE FAKIAKSPEA        60
     VAGLTGLKYQ VDATLTGAAL TQAMINIDQG NYSGAIANTL AAMSTATGLV ALAVDKPGLS       120
     TALNGLSGFL GASSNVAEKG PQIADALANA LSEIQKMQHD GTFPELDPGL MAGFAGEVLE       180
     GWSKEFYSWF PDDWNPWKNI DRNSDGVKKY HIYDPVVLDL DGDGIETIAA NKWAGVLFDH       240
     DNDGIRTSTG WVGSDDGILV LDRNGDGVIN DGSELFGDSV TLKDGSQASN GYAALAEFDS       300
     NGDGKVNAED TNFEQLKVWR DLNQDGVSQT NELFGLTELG IQSLNLNHTN TDTALGNDNI       360
     LAQTGSFETL DGQSHIMGDV NFSFNSIYSS FNNAIELTAE QQQAANLQGA GRVRDLREAA       420
     ALSPELAETL KNYSNAETKA EQYDLLDQLI LNWAKTDPDF KEANEVRMVS WVKTANEGIA       480
     LTPGQAAIVT LAAPLSKESQ AMLDKIHHIL PILDAFSGSK PSQIYYENEA DIKNVFNIIN       540
     NAYVSLKEGI YTGLLYQTRL DDYLAEIELN LQATDPTELF NYSGIQEKLE QIFIINPEKA       600
     FTDLSDLVNY HPDILTNWLP EGKTLLIQFL NEVIEQGLWD DLASKVDLKI LEQSGFIIGT       660
     KLDDTLNGTK NNDTLNGGWG NDKLNGGAGQ DTLIGGSGNA VMTGGDYEKD IYIFQSGHGQ       720
     DIINDKSYDW TNLQYFNDVK FEGANFTDAQ FLRVGNDLVI KAFGTDDSVS FKNYLNDNDS       780
     YSRDFNFIFA DKTLTTADVM NIVIPLNGTD GNDVQNGWKG KDNLLGSLGD DTLNGLAGDD       840
     WLEGGAGNDI LNGGEGNDLL EGGAGNDTLT GGIGADTAIF KILAGFGNDA TGGNGVDTWS       900
     DFNISQGDKI NISELIIGPA SKENLNQFVS FEKSGSTVTL SLDRDGNDIN YSATKLLILN       960
     NQTNVNSLND LIKADVFIV                                                    979
//

If you have problems or comments...

PBIL Back to PBIL home page