(data stored in ACNUC29543 zone)

EMBL: CP000521.PE774

CP000521.PE774       Location/Qualifiers
FT   CDS             complement(883242..884525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0746"
FT                   /product="ribonucleoside-diphosphate reductase beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0746"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11186"
FT                   /protein_id="ABO11186.2"
FT                   /translation="MSILSWDDFEDDSQKPAAPEHKSAPVNPEKTPDSQNVSAAQPSSQ
FT                   SVAAPQSAGTHSVRSTNPTDSMARASEALEHLDVAPGLEELEMGAQRVQVDDKAMINCR
FT                   ADLNQLVPFKYEWAWQKYLDGCANHWMPQEVNMNHDIALWKSENGLTEDERTIVMRSLG
FT                   FFSTADSLVANNLVLAIYRHITNPECRQYILRQAFEEAIHTHAYQYCIESLGMDEGEVF
FT                   NMYREIPSVARKAAWGLKYTQSLSDPTFHTGTPENDQRLLRNLIAFYCVLEGIFFYCGF
FT                   TQILSMGRRNKMNGVAEQFQYILRDESMHLNFGIDMINQIKIENPHLWTAEFQQEVIQM
FT                   ILEGTMLEIEYARDTMPRGVLGMNASMMEEYLKFICNRRLSQLGLPEQFAGVTNPFAWM
FT                   SEMMDLRKEKNFFETRVTDYQTGGALSW"
     MSILSWDDFE DDSQKPAAPE HKSAPVNPEK TPDSQNVSAA QPSSQSVAAP QSAGTHSVRS        60
     TNPTDSMARA SEALEHLDVA PGLEELEMGA QRVQVDDKAM INCRADLNQL VPFKYEWAWQ       120
     KYLDGCANHW MPQEVNMNHD IALWKSENGL TEDERTIVMR SLGFFSTADS LVANNLVLAI       180
     YRHITNPECR QYILRQAFEE AIHTHAYQYC IESLGMDEGE VFNMYREIPS VARKAAWGLK       240
     YTQSLSDPTF HTGTPENDQR LLRNLIAFYC VLEGIFFYCG FTQILSMGRR NKMNGVAEQF       300
     QYILRDESMH LNFGIDMINQ IKIENPHLWT AEFQQEVIQM ILEGTMLEIE YARDTMPRGV       360
     LGMNASMMEE YLKFICNRRL SQLGLPEQFA GVTNPFAWMS EMMDLRKEKN FFETRVTDYQ       420
     TGGALSW                                                                 427
//

If you have problems or comments...

PBIL Back to PBIL home page