(data stored in ACNUC29543 zone)

EMBL: CP000521.PE795

CP000521.PE795       Location/Qualifiers
FT   CDS             908836..909129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0766"
FT                   /product="putative cold shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0766"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11206"
FT                   /protein_id="ABO11206.1"
FT                   /translation="MKQEFYTGRVKQYNADKGFGFISTTEGDIFFHISDFPASEGEPKR
FT                   NEKVRFLAADNRGKFKAVKIERIDPNPAKTKKTKIADHNKAITSELLSNFRR"
     MKQEFYTGRV KQYNADKGFG FISTTEGDIF FHISDFPASE GEPKRNEKVR FLAADNRGKF        60
     KAVKIERIDP NPAKTKKTKI ADHNKAITSE LLSNFRR                                 97
//

If you have problems or comments...

PBIL Back to PBIL home page