(data stored in ACNUC29543 zone)

EMBL: CP000521.PE809

CP000521.PE809       Location/Qualifiers
FT   CDS             920513..921136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0777"
FT                   /product="putative threonine efflux protein (RhtC)"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0777"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11217"
FT                   /protein_id="ABO11217.2"
FT                   /translation="MFESLIPLFSIAMALMLGAISPGPSFIYVAQNSISKSRKHGLFTA
FT                   LGTGTGAALFGFLAVMGLQAVLLAVPSAYLILKIGGGLYLLWLAFKIIKHAKEPIAMEN
FT                   DAKSKMTYKQAYRYGLITQLSNPKIAVVLASVFTALLPKEIPNYYYVALPLICFMIDAG
FT                   WYSCVAMLLSSEKPRKMYLKAKTGVDRVAGSIVSVLGLKLIFFK"
     MFESLIPLFS IAMALMLGAI SPGPSFIYVA QNSISKSRKH GLFTALGTGT GAALFGFLAV        60
     MGLQAVLLAV PSAYLILKIG GGLYLLWLAF KIIKHAKEPI AMENDAKSKM TYKQAYRYGL       120
     ITQLSNPKIA VVLASVFTAL LPKEIPNYYY VALPLICFMI DAGWYSCVAM LLSSEKPRKM       180
     YLKAKTGVDR VAGSIVSVLG LKLIFFK                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page