(data stored in ACNUC29543 zone)

EMBL: CP000521.PE81

CP000521.PE81        Location/Qualifiers
FT   CDS             92999..95467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0077"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10570"
FT                   /protein_id="ABO10570.1"
FT                   /translation="MEKNDTFLSDLLTTYKKLKLSDANEAETRKKLIDVVIENVLGWTT
FT                   DDISYEERVSEDGETTYADYIIRTADVSILIEAKRLGSTFYTVPEKKKVKLSTFSEDDL
FT                   TGKAIKQAREYCRKKSIPFAAVTNGSQWIIFPAVRTDSVSFSDSTALVFDSIERILGEE
FT                   SSHFRGLLSRDGVIEGNLALELIGRKTDQFDERRLNKFFKGISIKKENPIYPLIEGAVV
FT                   SAFSDSIVDNDNSILEKCYVKNADRKKFDNRIEMHLQKREPLFNSQPKRPMRKRESSSL
FT                   VDSINKASHNKKPLAILILGTVGTGKTTFLQYTRRISSASFFEQKEKQPYPHWIEIDFR
FT                   TFSKNENPLDFIYDKLFDYIKTDKFFCDYDRSIKFAYEKEINSLKSGPLFLLANSDEEL
FT                   KKRITDLLIADYQAIKPYVDKLIGYASKLSPIFLIIDNVDQFEDDFIQSEIFSDSIAIA
FT                   SRLGINLIIAMRESTFINHRSSPTFDAFDFDPLHIEPPEIPAVLSRRFFLTGKLLEGKS
FT                   GEFIALNGANFKVEDLSVFIDIVKGSVLGTEVGEKIDVLSNHDVRLALRMTREFLARGY
FT                   TDPAKALITHKPEKRYTLPKQEAFRSILLGNQSVYSEEYSVIGNPFDSRLNRSNTELLR
FT                   IFVLSALVRKGSSNGQGYIEGQIIRDSLKTIGFSETDTLAILKDLCTLRFAHTKSHGKA
FT                   DINSSYFASRLGGHIIKSLIGDFTFIENILMDTFISEKDQWEQLKSISSSIQEERDIVR
FT                   KINQRIDRIKIFYELMISQYSILLSEATKRGLDPIWLSNPLIEMKDTLWSNCDKAYASA
FT                   NRIYGENAQK"
     MEKNDTFLSD LLTTYKKLKL SDANEAETRK KLIDVVIENV LGWTTDDISY EERVSEDGET        60
     TYADYIIRTA DVSILIEAKR LGSTFYTVPE KKKVKLSTFS EDDLTGKAIK QAREYCRKKS       120
     IPFAAVTNGS QWIIFPAVRT DSVSFSDSTA LVFDSIERIL GEESSHFRGL LSRDGVIEGN       180
     LALELIGRKT DQFDERRLNK FFKGISIKKE NPIYPLIEGA VVSAFSDSIV DNDNSILEKC       240
     YVKNADRKKF DNRIEMHLQK REPLFNSQPK RPMRKRESSS LVDSINKASH NKKPLAILIL       300
     GTVGTGKTTF LQYTRRISSA SFFEQKEKQP YPHWIEIDFR TFSKNENPLD FIYDKLFDYI       360
     KTDKFFCDYD RSIKFAYEKE INSLKSGPLF LLANSDEELK KRITDLLIAD YQAIKPYVDK       420
     LIGYASKLSP IFLIIDNVDQ FEDDFIQSEI FSDSIAIASR LGINLIIAMR ESTFINHRSS       480
     PTFDAFDFDP LHIEPPEIPA VLSRRFFLTG KLLEGKSGEF IALNGANFKV EDLSVFIDIV       540
     KGSVLGTEVG EKIDVLSNHD VRLALRMTRE FLARGYTDPA KALITHKPEK RYTLPKQEAF       600
     RSILLGNQSV YSEEYSVIGN PFDSRLNRSN TELLRIFVLS ALVRKGSSNG QGYIEGQIIR       660
     DSLKTIGFSE TDTLAILKDL CTLRFAHTKS HGKADINSSY FASRLGGHII KSLIGDFTFI       720
     ENILMDTFIS EKDQWEQLKS ISSSIQEERD IVRKINQRID RIKIFYELMI SQYSILLSEA       780
     TKRGLDPIWL SNPLIEMKDT LWSNCDKAYA SANRIYGENA QK                          822
//

If you have problems or comments...

PBIL Back to PBIL home page