(data stored in ACNUC29543 zone)

EMBL: CP000521.PE82

CP000521.PE82        Location/Qualifiers
FT   CDS             96053..96277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0078"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10571"
FT                   /protein_id="ABO10571.1"
FT                   /translation="METILGLCIGVGLSAACGFRVFVPLLVMSIATMMGWFEPSKGFEW
FT                   LALPSVCLALGVATVCEVAAYYIPWAIMP"
     METILGLCIG VGLSAACGFR VFVPLLVMSI ATMMGWFEPS KGFEWLALPS VCLALGVATV        60
     CEVAAYYIPW AIMP                                                          74
//

If you have problems or comments...

PBIL Back to PBIL home page