(data stored in ACNUC29543 zone)

EMBL: CP000521.PE821

CP000521.PE821       Location/Qualifiers
FT   CDS             932990..933715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0787"
FT                   /product="putative signal peptide"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0787"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11227"
FT                   /protein_id="ABO11227.2"
FT                   /translation="MKKITALLFALCATVTHAELQTLDNDALQAINGQAGADLSLMLNL
FT                   NQTSNGIFDNGSGGVCENVEFCHIGLAINKRFVQADTTKPSGWAENSDSGNKLWLVFKG
FT                   VQGTLNIQKMGLDGADLKYLDKSNTEIIKPAIQLSFSAAQPILIRNFGFNALSIEQDNF
FT                   TSSTTTQGSSANMYDYAYFKKPTYAATANSANQQVATATPSAYDYGRETGFMGLMMSGN
FT                   MAIQGKVMVFSCDGSHPRC"
     MKKITALLFA LCATVTHAEL QTLDNDALQA INGQAGADLS LMLNLNQTSN GIFDNGSGGV        60
     CENVEFCHIG LAINKRFVQA DTTKPSGWAE NSDSGNKLWL VFKGVQGTLN IQKMGLDGAD       120
     LKYLDKSNTE IIKPAIQLSF SAAQPILIRN FGFNALSIEQ DNFTSSTTTQ GSSANMYDYA       180
     YFKKPTYAAT ANSANQQVAT ATPSAYDYGR ETGFMGLMMS GNMAIQGKVM VFSCDGSHPR       240
     C                                                                       241
//

If you have problems or comments...

PBIL Back to PBIL home page