(data stored in ACNUC29543 zone)

EMBL: CP000521.PE825

CP000521.PE825       Location/Qualifiers
FT   CDS             complement(938383..939192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0790"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0790"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11230"
FT                   /protein_id="ABO11230.2"
FT                   /translation="MISLPLVYTILALIAYTTSFWYLFIRLMSKREPNPWLFAFVTTLA
FT                   LLLHGTVLCHAMLTPSGINYDVFNLVSFTSGLMLLLSLVFSTFRPIVPLNLLGIPVAAI
FT                   GLILGFAFSRPDQFIEQHSLGLDTHIILSLSAYAVLLMATIHAILIWFQNRELKKKQKK
FT                   RIWVNLLPSIQAMESLLFDLIITGFILLTIALAFGFLTVDSFFAQHLAHKTVFSIISWF
FT                   IYGSLLIGHYKLGWRGQKAIRFTLIGFALLAIGFIGSKFVLEMILGR"
     MISLPLVYTI LALIAYTTSF WYLFIRLMSK REPNPWLFAF VTTLALLLHG TVLCHAMLTP        60
     SGINYDVFNL VSFTSGLMLL LSLVFSTFRP IVPLNLLGIP VAAIGLILGF AFSRPDQFIE       120
     QHSLGLDTHI ILSLSAYAVL LMATIHAILI WFQNRELKKK QKKRIWVNLL PSIQAMESLL       180
     FDLIITGFIL LTIALAFGFL TVDSFFAQHL AHKTVFSIIS WFIYGSLLIG HYKLGWRGQK       240
     AIRFTLIGFA LLAIGFIGSK FVLEMILGR                                         269
//

If you have problems or comments...

PBIL Back to PBIL home page