(data stored in ACNUC29543 zone)

EMBL: CP000521.PE83

CP000521.PE83        Location/Qualifiers
FT   CDS             96301..96627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3485"
FT                   /old_locus_tag="AS1_3485"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3485"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89910"
FT                   /protein_id="ABS89910.1"
FT                   /translation="MIAGTLATMAVSSGEMSQFASWAAAIIVGGGTAGVVQMSTVAARG
FT                   VSTATTGGLGNFIVATGEWIGAILLSVSAMLVPALVAIVVLIAVIWVVRWIRHKKQEQA
FT                   HTPL"
     MIAGTLATMA VSSGEMSQFA SWAAAIIVGG GTAGVVQMST VAARGVSTAT TGGLGNFIVA        60
     TGEWIGAILL SVSAMLVPAL VAIVVLIAVI WVVRWIRHKK QEQAHTPL                    108
//

If you have problems or comments...

PBIL Back to PBIL home page