(data stored in ACNUC29543 zone)

EMBL: CP000521.PE87

CP000521.PE87        Location/Qualifiers
FT   CDS             complement(100092..100784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0081"
FT                   /product="putative signal peptide"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10574"
FT                   /protein_id="ABO10574.2"
FT                   /translation="MKIKKSAFYIFTMIFSLHSSAFAEPSVADVQYRAQQGQPIAQYHL
FT                   GIMLLTGEQGVVKNYEQAFKWLTAADQNGSVGAKYSLGMMYFTGTGVEKDMKRAFEYFA
FT                   KAADKGHAKAQYNLGVLYDRGEGTAQNYEQAFEWYSRAAEQGYPPAEYNLAHLYKKGHG
FT                   VAQSDEQALKWYTKAAEHNESDAQYNLAQMYLNGEGTPKNLQLAKKWFQQAADAGDSDA
FT                   KEMLKSLD"
     MKIKKSAFYI FTMIFSLHSS AFAEPSVADV QYRAQQGQPI AQYHLGIMLL TGEQGVVKNY        60
     EQAFKWLTAA DQNGSVGAKY SLGMMYFTGT GVEKDMKRAF EYFAKAADKG HAKAQYNLGV       120
     LYDRGEGTAQ NYEQAFEWYS RAAEQGYPPA EYNLAHLYKK GHGVAQSDEQ ALKWYTKAAE       180
     HNESDAQYNL AQMYLNGEGT PKNLQLAKKW FQQAADAGDS DAKEMLKSLD                  230
//

If you have problems or comments...

PBIL Back to PBIL home page