(data stored in ACNUC29543 zone)

EMBL: CP000521.PE90

CP000521.PE90        Location/Qualifiers
FT   CDS             108043..108744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0088"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10577"
FT                   /protein_id="ABO10577.1"
FT                   /translation="MENKNQCRQCAVCGKSFPLKDLVSGEVIRNVISDEILKDHPDWSY
FT                   SSFICRADLADYRIKYVQSLLRSEKGELSNLENEVIGSMQRHELISRNTESDFDQNWTF
FT                   GEKLADKIASFGGSWAFLICFALFLTGWIVLNTVVIVVRPVDPYPFILLNLVLSCLAAI
FT                   QAPIIMMSQNRQEAKDRLRSQHDYQINLKAELEIRHLHEKMDHLLSHQWERLAHIQEIQ
FT                   LDLLAEMNKKR"
     MENKNQCRQC AVCGKSFPLK DLVSGEVIRN VISDEILKDH PDWSYSSFIC RADLADYRIK        60
     YVQSLLRSEK GELSNLENEV IGSMQRHELI SRNTESDFDQ NWTFGEKLAD KIASFGGSWA       120
     FLICFALFLT GWIVLNTVVI VVRPVDPYPF ILLNLVLSCL AAIQAPIIMM SQNRQEAKDR       180
     LRSQHDYQIN LKAELEIRHL HEKMDHLLSH QWERLAHIQE IQLDLLAEMN KKR              233
//

If you have problems or comments...

PBIL Back to PBIL home page