(data stored in ACNUC29543 zone)

EMBL: CP000521.PE93

CP000521.PE93        Location/Qualifiers
FT   CDS             110034..110414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0091"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10580"
FT                   /protein_id="ABO10580.1"
FT                   /translation="MSLSQKEIAVRFLELAAAGEVDEAYGNYTAPNFKHHNPYYAGDKT
FT                   SLKEGMRESAVETPNKVLEVQHVIEDGALVAVHSKLEMQMNNKLTILAVVHICRFENGK
FT                   IAEFWDIGQIQPDPLVNENGMF"
     MSLSQKEIAV RFLELAAAGE VDEAYGNYTA PNFKHHNPYY AGDKTSLKEG MRESAVETPN        60
     KVLEVQHVIE DGALVAVHSK LEMQMNNKLT ILAVVHICRF ENGKIAEFWD IGQIQPDPLV       120
     NENGMF                                                                  126
//

If you have problems or comments...

PBIL Back to PBIL home page