(data stored in ACNUC7421 zone)

EMBL: CP000529.PE101

CP000529.PE101       Location/Qualifiers
FT   CDS             complement(110417..110683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0103"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35428"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIF0"
FT                   /protein_id="ABM35428.1"
FT                   /translation="MFCISFEGHDVATDGDVLKMALPGNRGENNNDTISRQNQLPRFLH
FT                   EWPPRLEAAQSLISKNVPALTRAKRGHWPAFIEITLFTLEFSR"
     MFCISFEGHD VATDGDVLKM ALPGNRGENN NDTISRQNQL PRFLHEWPPR LEAAQSLISK        60
     NVPALTRAKR GHWPAFIEIT LFTLEFSR                                           88
//

If you have problems or comments...

PBIL Back to PBIL home page