(data stored in ACNUC7421 zone)

EMBL: CP000529.PE105

CP000529.PE105       Location/Qualifiers
FT   CDS             complement(115233..115898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0107"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; KEGG: rfr:Rfer_3383
FT                   ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35432"
FT                   /db_xref="GOA:A1VIF4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR005895"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIF4"
FT                   /protein_id="ABM35432.1"
FT                   /translation="MHPEPETPILMAEGLSFSHSQPSAPPLFDQLSLVLAPGVTWVCGD
FT                   EGTGKTTLLQLLAGKLPSTGQLRIQGVCLTQEREAYQRQVAWFDPRATALDQQTARQIF
FT                   AGLPQRHPGCDLDALQAHIDGLSLAPHLDKALFMLSTGSRRKVFLAAALAARAPVTLLD
FT                   QPFMALDRPSIDYLLAVLAEAARQPGRAWVVADYEAPGQVALAAVVKLGEPGPISVPN"
     MHPEPETPIL MAEGLSFSHS QPSAPPLFDQ LSLVLAPGVT WVCGDEGTGK TTLLQLLAGK        60
     LPSTGQLRIQ GVCLTQEREA YQRQVAWFDP RATALDQQTA RQIFAGLPQR HPGCDLDALQ       120
     AHIDGLSLAP HLDKALFMLS TGSRRKVFLA AALAARAPVT LLDQPFMALD RPSIDYLLAV       180
     LAEAARQPGR AWVVADYEAP GQVALAAVVK LGEPGPISVP N                           221
//

If you have problems or comments...

PBIL Back to PBIL home page