(data stored in ACNUC7421 zone)

EMBL: CP000529.PE107

CP000529.PE107       Location/Qualifiers
FT   CDS             116291..116764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0109"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_0164 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35434"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIF6"
FT                   /protein_id="ABM35434.1"
FT                   /translation="MHTMKSSTRVFSLCAAPALVLVLAGCASSGAGSASARPVLYPNAT
FT                   LNRVGDAQGRMEANACMSRAQASGLSPMQTTNEVGRRAGEGAAIAGVASAVGALITGRG
FT                   GEGMLRAGAAGAAVGGSAGAVSGAFHNDKPNGVYRNFVQRCLSEKGFEVIGWN"
     MHTMKSSTRV FSLCAAPALV LVLAGCASSG AGSASARPVL YPNATLNRVG DAQGRMEANA        60
     CMSRAQASGL SPMQTTNEVG RRAGEGAAIA GVASAVGALI TGRGGEGMLR AGAAGAAVGG       120
     SAGAVSGAFH NDKPNGVYRN FVQRCLSEKG FEVIGWN                                157
//

If you have problems or comments...

PBIL Back to PBIL home page