(data stored in ACNUC7421 zone)

EMBL: CP000529.PE108

CP000529.PE108       Location/Qualifiers
FT   CDS             116771..117349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0110"
FT                   /product="MOSC domain containing protein"
FT                   /note="PFAM: MOSC domain containing protein; KEGG:
FT                   rme:Rmet_3580 MOSC domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35435"
FT                   /db_xref="GOA:A1VIF7"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIF7"
FT                   /protein_id="ABM35435.1"
FT                   /translation="MPQLLSVQVGLARRTNIGERSILTAYGKQPVAQAVPVLPLGLLGD
FT                   DQADLSVHGGLAKAVYAYPSEHYAYWQAARRGAGVGEIDASLPHGSLGENLTLQGLLET
FT                   EVWAGDVLKFPGCELRVTLPREPCYKFNAAMGFGRASKLMAQTGFCGFYLAVQTSGTLR
FT                   AGESFEVIPGRRGVGIPALFAAKMSKHLR"
     MPQLLSVQVG LARRTNIGER SILTAYGKQP VAQAVPVLPL GLLGDDQADL SVHGGLAKAV        60
     YAYPSEHYAY WQAARRGAGV GEIDASLPHG SLGENLTLQG LLETEVWAGD VLKFPGCELR       120
     VTLPREPCYK FNAAMGFGRA SKLMAQTGFC GFYLAVQTSG TLRAGESFEV IPGRRGVGIP       180
     ALFAAKMSKH LR                                                           192
//

If you have problems or comments...

PBIL Back to PBIL home page