(data stored in ACNUC7421 zone)

EMBL: CP000529.PE11

CP000529.PE11        Location/Qualifiers
FT   CDS             complement(9620..10642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0012"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_0024 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35338"
FT                   /db_xref="GOA:A1VI60"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:A1VI60"
FT                   /protein_id="ABM35338.1"
FT                   /translation="MPDSRILPQPAPSDSEPGARRRKLTDRPWWPWLRRGATTVFFGLV
FT                   GYLLVSQARTIEWDKVLSSLQDYPLTASWGAVALAAASYLLYSCFDLLGRHYTGHTLRA
FT                   PTVMLLTFVSYAFNLNLGSVVGGVAFRLRLYSRLGLALGTITRIMSFSMLANWMGYLLL
FT                   AGLVFSLKPPALPNSWKIDASQLRLTGLALLAVALAYLGACAFSRQRTLRLRGHDIELP
FT                   SLKLASLQLAMGAGNWLLMSGIVFILLQQRIDFFSVASVLLLAAIAGVITHIPGNLGVL
FT                   EAVFVALLSQRMPRHDLLAGLVAYRVVYYLLPLLVAAVIYLVMEARAKKPGRPGAALKP
FT                   "
     MPDSRILPQP APSDSEPGAR RRKLTDRPWW PWLRRGATTV FFGLVGYLLV SQARTIEWDK        60
     VLSSLQDYPL TASWGAVALA AASYLLYSCF DLLGRHYTGH TLRAPTVMLL TFVSYAFNLN       120
     LGSVVGGVAF RLRLYSRLGL ALGTITRIMS FSMLANWMGY LLLAGLVFSL KPPALPNSWK       180
     IDASQLRLTG LALLAVALAY LGACAFSRQR TLRLRGHDIE LPSLKLASLQ LAMGAGNWLL       240
     MSGIVFILLQ QRIDFFSVAS VLLLAAIAGV ITHIPGNLGV LEAVFVALLS QRMPRHDLLA       300
     GLVAYRVVYY LLPLLVAAVI YLVMEARAKK PGRPGAALKP                             340
//

If you have problems or comments...

PBIL Back to PBIL home page