(data stored in ACNUC7421 zone)

EMBL: CP000529.PE112

CP000529.PE112       Location/Qualifiers
FT   CDS             complement(122049..123968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0114"
FT                   /product="ATP-dependent DNA helicase RecQ"
FT                   /EC_number="3.6.1.-"
FT                   /note="KEGG: pol:Bpro_0170 ATP-dependent DNA helicase RecQ;
FT                   TIGRFAM: ATP-dependent DNA helicase, RecQ family;
FT                   ATP-dependent DNA helicase RecQ; PFAM: helicase domain
FT                   protein; HRDC domain protein; DEAD/DEAH box helicase domain
FT                   protein; SMART: DEAD-like helicases-like"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35439"
FT                   /db_xref="GOA:A1VIG1"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR006293"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIG1"
FT                   /protein_id="ABM35439.1"
FT                   /translation="MSGPPLSSLPISSAPSDQPTPLDVLGQVFGYSDFRGPQQAIVEHV
FT                   IAGGDALVLMPTGGGKSLCYQIPAIARQNAGHGVTIVISPLIALMHDQVGALLEAGVSA
FT                   AFLNSTQTFEESSQLEKQLLRNELTLLYAAPERINTPRMKGLLASLHERGLLSLFAIDE
FT                   AHCVSQWGHDFRPEYRSLSLLHETFPDVPRMALTATADALTRQDMIERLKLEDARLFLS
FT                   SFDRPNIRYTIVEKTDATRQLLRFIQAEHHGEAGIVYCQSRKRVEEIAGMLEDAGIKAM
FT                   AYHAGLDAKLRQQRQDRFLREDGCVMVATIAFGMGIDKPDVRFVAHLDMPKNIEGYYQE
FT                   TGRAGRDGLPADAWMVYGLQDVVNQRRMIDTSEVASEEFKAVMRGKLDALLTLAEGTRC
FT                   RRVSLLGYFGEASEPCGNCDNCLTPPAVWDATEAARKMLSCIYRVQQASGISFGAGHIM
FT                   DILRGKPTEKVVQYGHDQLSTFGIGADLAEPQWRGVLRQLIASNLVRVNAEAFNTLQLM
FT                   PDARQVLKGEVSVLLRQQAASAKAERTRRGSKSTVKTSVKGMAEATLNAGALERLGRLK
FT                   AWRTDVAREHNLPPFVIFHDATLRAIAEQAPQDLHALSGISGMGVKKLAAYGAEVLRVC
FT                   AEPG"
     MSGPPLSSLP ISSAPSDQPT PLDVLGQVFG YSDFRGPQQA IVEHVIAGGD ALVLMPTGGG        60
     KSLCYQIPAI ARQNAGHGVT IVISPLIALM HDQVGALLEA GVSAAFLNST QTFEESSQLE       120
     KQLLRNELTL LYAAPERINT PRMKGLLASL HERGLLSLFA IDEAHCVSQW GHDFRPEYRS       180
     LSLLHETFPD VPRMALTATA DALTRQDMIE RLKLEDARLF LSSFDRPNIR YTIVEKTDAT       240
     RQLLRFIQAE HHGEAGIVYC QSRKRVEEIA GMLEDAGIKA MAYHAGLDAK LRQQRQDRFL       300
     REDGCVMVAT IAFGMGIDKP DVRFVAHLDM PKNIEGYYQE TGRAGRDGLP ADAWMVYGLQ       360
     DVVNQRRMID TSEVASEEFK AVMRGKLDAL LTLAEGTRCR RVSLLGYFGE ASEPCGNCDN       420
     CLTPPAVWDA TEAARKMLSC IYRVQQASGI SFGAGHIMDI LRGKPTEKVV QYGHDQLSTF       480
     GIGADLAEPQ WRGVLRQLIA SNLVRVNAEA FNTLQLMPDA RQVLKGEVSV LLRQQAASAK       540
     AERTRRGSKS TVKTSVKGMA EATLNAGALE RLGRLKAWRT DVAREHNLPP FVIFHDATLR       600
     AIAEQAPQDL HALSGISGMG VKKLAAYGAE VLRVCAEPG                              639
//

If you have problems or comments...

PBIL Back to PBIL home page