(data stored in ACNUC7421 zone)

EMBL: CP000529.PE114

CP000529.PE114       Location/Qualifiers
FT   CDS             complement(125288..125872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0116"
FT                   /product="cyclic nucleotide-binding protein"
FT                   /note="PFAM: cyclic nucleotide-binding; KEGG: pol:Bpro_0173
FT                   cyclic nucleotide-binding domain (cNMP-BD) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35441"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIG3"
FT                   /protein_id="ABM35441.1"
FT                   /translation="MFKNIFKKPLLPADGRHQDKAGGSGSADLAAEMLIAPTALMQLSL
FT                   EEARVVVLYMQPQLVAKGTIFIREGDGRDTGFMMLLLDGEVTVETVVVSRAQPIIITVM
FT                   GPGSLIGELGFLDAQPRYASCIAATPLRCAILTREALNRLMLENAPVAAKLMLALSLRI
FT                   GVRLREITDKLKMYVQLTQAMEQEIASRITP"
     MFKNIFKKPL LPADGRHQDK AGGSGSADLA AEMLIAPTAL MQLSLEEARV VVLYMQPQLV        60
     AKGTIFIREG DGRDTGFMML LLDGEVTVET VVVSRAQPII ITVMGPGSLI GELGFLDAQP       120
     RYASCIAATP LRCAILTREA LNRLMLENAP VAAKLMLALS LRIGVRLREI TDKLKMYVQL       180
     TQAMEQEIAS RITP                                                         194
//

If you have problems or comments...

PBIL Back to PBIL home page