(data stored in ACNUC7421 zone)

EMBL: CP000529.PE117

CP000529.PE117       Location/Qualifiers
FT   CDS             complement(130589..132136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0119"
FT                   /product="Mg chelatase, subunit ChlI"
FT                   /note="KEGG: pol:Bpro_0181 Mg chelatase-related protein;
FT                   TIGRFAM: Mg chelatase, subunit ChlI; PFAM: magnesium
FT                   chelatase, ChlI subunit; ATPase associated with various
FT                   cellular activities, AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35444"
FT                   /db_xref="GOA:A1VIG6"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIG6"
FT                   /protein_id="ABM35444.1"
FT                   /translation="MSLSLVHSRALLGLQAHPVCVEVHLANGLPSFTLVGLADTEVKEA
FT                   RERVRSAIQNAGLEFPGNKRITVNLAPADLPKDSGRFDLPIALGILAASGQIDARKLAG
FT                   YEFAGELSLGGDVRPVRGALAMSLAIARPAHGGTARKLPRLVLPEGSAQEAALVPDAEI
FT                   YRAHHLLDVVRQFLPGDAVPEVADGWMRVASAAPSRQPAYADLADVKGQAAARRALEIA
FT                   AAGGHSLLMVGSPGSGKSMLAQRFAGLLPAMTTEEALETAAVASLGGRFTLDHWAVRPT
FT                   CAPHHTASAVALVGGGSPPRPGEISLAHRGVLFLDELPEFPRAALEALREPLESGSITI
FT                   SRAASRAEFPARFQLIAAMNPCPCGYLGSSLRACRCSPEQVSRYQGKLSGPLLDRIDLH
FT                   VEVGALAAGELVNTPPGEATETIRSRVVQARERAMSRQGSANQALQGQAIDAQCQLDAT
FT                   AAKFLNTAATRLGWSGRGIHRCLKVARTIADLAGAKTVQLTHVAEAVQYRRALKAAH"
     MSLSLVHSRA LLGLQAHPVC VEVHLANGLP SFTLVGLADT EVKEARERVR SAIQNAGLEF        60
     PGNKRITVNL APADLPKDSG RFDLPIALGI LAASGQIDAR KLAGYEFAGE LSLGGDVRPV       120
     RGALAMSLAI ARPAHGGTAR KLPRLVLPEG SAQEAALVPD AEIYRAHHLL DVVRQFLPGD       180
     AVPEVADGWM RVASAAPSRQ PAYADLADVK GQAAARRALE IAAAGGHSLL MVGSPGSGKS       240
     MLAQRFAGLL PAMTTEEALE TAAVASLGGR FTLDHWAVRP TCAPHHTASA VALVGGGSPP       300
     RPGEISLAHR GVLFLDELPE FPRAALEALR EPLESGSITI SRAASRAEFP ARFQLIAAMN       360
     PCPCGYLGSS LRACRCSPEQ VSRYQGKLSG PLLDRIDLHV EVGALAAGEL VNTPPGEATE       420
     TIRSRVVQAR ERAMSRQGSA NQALQGQAID AQCQLDATAA KFLNTAATRL GWSGRGIHRC       480
     LKVARTIADL AGAKTVQLTH VAEAVQYRRA LKAAH                                  515
//

If you have problems or comments...

PBIL Back to PBIL home page