(data stored in ACNUC7421 zone)

EMBL: CP000529.PE119

CP000529.PE119       Location/Qualifiers
FT   CDS             132847..134412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0121"
FT                   /product="ammonium transporter"
FT                   /note="TIGRFAM: ammonium transporter; PFAM: Rh family
FT                   protein/ammonium transporter; KEGG: pol:Bpro_0184 ammonium
FT                   transporter; TC 1.A.11"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35446"
FT                   /db_xref="GOA:A1VIG8"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIG8"
FT                   /protein_id="ABM35446.1"
FT                   /translation="MKKLIASLLLGLSLLGTGATAWAQAPAEAPAATASAPAEAKPDAA
FT                   AAPASAPADTAAPAAAAPAPAAEASAAAAPAPVPNKGDTAWMMVSTILVILMVVPGLAL
FT                   FYGGLVRSKNMLSVLMQVMVTFSLIVVLWFIYGYSLAFTEGNAFIGGFDRLFMKGIWDN
FT                   AAGTFANAATFSKGVVIPEIVFAAFQATFAGITCTLIVGAFAERIKFSAVLAFMVIWFT
FT                   FSYAPMAHMVWFWMGPDAYTGKEVVDAMTGKAGYIWQTGALDFAGGTVVHINAAVAGLV
FT                   GAFMVGKRIGYGKEAMAPHSLTLTMVGASLLWVGWFGFNAGSALEANGFAALAFINTLG
FT                   ATAAAVLAWCVGEALLKGKASMLGAASGAVAGLVAITPAAGNVGIAGGLAIGFIAGFAC
FT                   LWGVHGLKKILGADDSLDVFGVHGVGGIVGALLTGVFNSPALGGPGYVADWVTAAMVTT
FT                   ADYSIMSQVWIQAKAVLITIVWSGVVSLVAYKIVDLTIGLRVSEEDEREGLDITAHGET
FT                   AYNR"
     MKKLIASLLL GLSLLGTGAT AWAQAPAEAP AATASAPAEA KPDAAAAPAS APADTAAPAA        60
     AAPAPAAEAS AAAAPAPVPN KGDTAWMMVS TILVILMVVP GLALFYGGLV RSKNMLSVLM       120
     QVMVTFSLIV VLWFIYGYSL AFTEGNAFIG GFDRLFMKGI WDNAAGTFAN AATFSKGVVI       180
     PEIVFAAFQA TFAGITCTLI VGAFAERIKF SAVLAFMVIW FTFSYAPMAH MVWFWMGPDA       240
     YTGKEVVDAM TGKAGYIWQT GALDFAGGTV VHINAAVAGL VGAFMVGKRI GYGKEAMAPH       300
     SLTLTMVGAS LLWVGWFGFN AGSALEANGF AALAFINTLG ATAAAVLAWC VGEALLKGKA       360
     SMLGAASGAV AGLVAITPAA GNVGIAGGLA IGFIAGFACL WGVHGLKKIL GADDSLDVFG       420
     VHGVGGIVGA LLTGVFNSPA LGGPGYVADW VTAAMVTTAD YSIMSQVWIQ AKAVLITIVW       480
     SGVVSLVAYK IVDLTIGLRV SEEDEREGLD ITAHGETAYN R                           521
//

If you have problems or comments...

PBIL Back to PBIL home page