(data stored in ACNUC7421 zone)

EMBL: CP000529.PE121

CP000529.PE121       Location/Qualifiers
FT   CDS             135697..136845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0123"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   rfr:Rfer_0480 FAD linked oxidase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35448"
FT                   /db_xref="GOA:A1VIH0"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIH0"
FT                   /protein_id="ABM35448.1"
FT                   /translation="MNADTDMTTLMAARVRDAAQAGTPLRIRGGGSKDFYGQALAGDVL
FT                   DLSGHAGVISYEPSELVVTVRGGTPLAELEALLAGQGQCLPFEPPHFGPNATVGGMVAS
FT                   GLSGPARASSGAVRDYLLGVVLLNGKGESLTFGGQVMKNVAGYDVSRLMAGTLGTLGVL
FT                   LEISLKVLPVAPAEATLACRLPQQKALDLLNRWGGQPLPLNASCWVHDDSAAPGQDFLF
FT                   VRLRGAVAAVEAACPRMMADVQAAGGQAARMDQAQAGADWNACREQTLPFFARPPALDA
FT                   CLWRLSVPQTTLALDLPFPQLIEWHGGLRWLWAPASAAAQLRRLAAQAGGHATVFRRAA
FT                   QTPAELPVFAPLSPVQSRIAQALRKEFDPAGVFNPGRMSMDR"
     MNADTDMTTL MAARVRDAAQ AGTPLRIRGG GSKDFYGQAL AGDVLDLSGH AGVISYEPSE        60
     LVVTVRGGTP LAELEALLAG QGQCLPFEPP HFGPNATVGG MVASGLSGPA RASSGAVRDY       120
     LLGVVLLNGK GESLTFGGQV MKNVAGYDVS RLMAGTLGTL GVLLEISLKV LPVAPAEATL       180
     ACRLPQQKAL DLLNRWGGQP LPLNASCWVH DDSAAPGQDF LFVRLRGAVA AVEAACPRMM       240
     ADVQAAGGQA ARMDQAQAGA DWNACREQTL PFFARPPALD ACLWRLSVPQ TTLALDLPFP       300
     QLIEWHGGLR WLWAPASAAA QLRRLAAQAG GHATVFRRAA QTPAELPVFA PLSPVQSRIA       360
     QALRKEFDPA GVFNPGRMSM DR                                                382
//

If you have problems or comments...

PBIL Back to PBIL home page