(data stored in ACNUC7421 zone)

EMBL: CP000529.PE122

CP000529.PE122       Location/Qualifiers
FT   CDS             136854..137618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0124"
FT                   /product="protein of unknown function DUF1275"
FT                   /note="PFAM: protein of unknown function DUF1275; KEGG:
FT                   bur:Bcep18194_C7065 protein of unknown function DUF1275"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35449"
FT                   /db_xref="GOA:A1VIH1"
FT                   /db_xref="InterPro:IPR010699"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIH1"
FT                   /protein_id="ABM35449.1"
FT                   /translation="MRRLRHLTGQHRTASINRLLGAVLAFNAGAINAGGFLVVHMYTSH
FT                   MTGFASLLADNLVLGNMRLVLGAIGALLAFTFGAAFTAIQVNWARQHGLRSEYALPLLV
FT                   EALLLLLFGLMGATLNRQTPFAVPLTVLVLSFTMGLQNALVSKVSSSQIRTTHMTGIVT
FT                   DIGIELGKLFYWNRIEGPFESRVRANRIKLRLLCILLGAFVAGGIVGAAGFKYVGFIWV
FT                   VPLALLLLALCLPPLYSDLLRTFRRKLLRQGT"
     MRRLRHLTGQ HRTASINRLL GAVLAFNAGA INAGGFLVVH MYTSHMTGFA SLLADNLVLG        60
     NMRLVLGAIG ALLAFTFGAA FTAIQVNWAR QHGLRSEYAL PLLVEALLLL LFGLMGATLN       120
     RQTPFAVPLT VLVLSFTMGL QNALVSKVSS SQIRTTHMTG IVTDIGIELG KLFYWNRIEG       180
     PFESRVRANR IKLRLLCILL GAFVAGGIVG AAGFKYVGFI WVVPLALLLL ALCLPPLYSD       240
     LLRTFRRKLL RQGT                                                         254
//

If you have problems or comments...

PBIL Back to PBIL home page