(data stored in ACNUC7421 zone)

EMBL: CP000529.PE123

CP000529.PE123       Location/Qualifiers
FT   CDS             137627..138874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0125"
FT                   /product="protein of unknown function DUF224, cysteine-rich
FT                   region domain protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; protein of unknown function DUF224, cysteine-rich
FT                   region domain protein; KEGG: pol:Bpro_0188 protein of
FT                   unknown function DUF224, cysteine-rich region"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35450"
FT                   /db_xref="GOA:A1VIH2"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012257"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIH2"
FT                   /protein_id="ABM35450.1"
FT                   /translation="MQTQLAPEFQNTPDGRQAEAILRKCVHCGFCTATCPTYQLLGDEL
FT                   DGPRGRIYLIKQVLEGETPTRKTQLHLDRCLTCRNCESTCPSGVQYGHLVDIGRKLVDE
FT                   RVPRPVGERAVRWALKEGLPSPLFAPAMKIGQAVRGLLPESLKAKVPPKQPAGQWPTRS
FT                   HARKMLMLEGCVQPAMMPNINSATARVLDAAGIEVVTAAKAGCCGAVKFHLNDQDGGKL
FT                   EMRRNIDAWWPYVEQGVEALVMNASGCGVTVKEYGYILKDDAAYAEKAARISALTRDLS
FT                   ELLPVIAESLQASRPDLAGKIAAGAPRLAFHPPCTLQHGQQLRGGVEQHLGALGFDIKV
FT                   SGNEAHLCCGSAGTYSVLNPEIAYQLRDRKLANLDAMAPEVIVSANIGCITHLQSGTTT
FT                   PVRHWVEVLNEALLNQ"
     MQTQLAPEFQ NTPDGRQAEA ILRKCVHCGF CTATCPTYQL LGDELDGPRG RIYLIKQVLE        60
     GETPTRKTQL HLDRCLTCRN CESTCPSGVQ YGHLVDIGRK LVDERVPRPV GERAVRWALK       120
     EGLPSPLFAP AMKIGQAVRG LLPESLKAKV PPKQPAGQWP TRSHARKMLM LEGCVQPAMM       180
     PNINSATARV LDAAGIEVVT AAKAGCCGAV KFHLNDQDGG KLEMRRNIDA WWPYVEQGVE       240
     ALVMNASGCG VTVKEYGYIL KDDAAYAEKA ARISALTRDL SELLPVIAES LQASRPDLAG       300
     KIAAGAPRLA FHPPCTLQHG QQLRGGVEQH LGALGFDIKV SGNEAHLCCG SAGTYSVLNP       360
     EIAYQLRDRK LANLDAMAPE VIVSANIGCI THLQSGTTTP VRHWVEVLNE ALLNQ            415
//

If you have problems or comments...

PBIL Back to PBIL home page