(data stored in ACNUC7421 zone)

EMBL: CP000529.PE127

CP000529.PE127       Location/Qualifiers
FT   CDS             complement(141352..142260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0129"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6,
FT                   transmembrane; KEGG: pol:Bpro_0191 protein of unknown
FT                   function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35454"
FT                   /db_xref="GOA:A1VIH6"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIH6"
FT                   /protein_id="ABM35454.1"
FT                   /translation="MAGLHPARAAHGRTAALAVGALVLNALVWGVSWWPFRQLQDHGLH
FT                   PLWATALMYLLIVAGLLAVQFKAWRGFAAHPQLWLLGLAAGLTNIGFNWAVTVGDVVRV
FT                   VLLFYLMPAWSVLVAWLLLGEKPTAASLFRLLLAMSGVLIVLKAPGSAWPLPQGAADWL
FT                   AIAGGFSFAVTNCLLRKFADAPGNTCMLAMFGGSGLMATLAALLGMSLQVVPGPALQAA
FT                   GIPVLLGLSLAFMASNAALQYGAARLAAGATAIVMLTEILFASGSAAALGAAQFTPRIL
FT                   LGGSLIVLAAVLAATAPSAKE"
     MAGLHPARAA HGRTAALAVG ALVLNALVWG VSWWPFRQLQ DHGLHPLWAT ALMYLLIVAG        60
     LLAVQFKAWR GFAAHPQLWL LGLAAGLTNI GFNWAVTVGD VVRVVLLFYL MPAWSVLVAW       120
     LLLGEKPTAA SLFRLLLAMS GVLIVLKAPG SAWPLPQGAA DWLAIAGGFS FAVTNCLLRK       180
     FADAPGNTCM LAMFGGSGLM ATLAALLGMS LQVVPGPALQ AAGIPVLLGL SLAFMASNAA       240
     LQYGAARLAA GATAIVMLTE ILFASGSAAA LGAAQFTPRI LLGGSLIVLA AVLAATAPSA       300
     KE                                                                      302
//

If you have problems or comments...

PBIL Back to PBIL home page