(data stored in ACNUC7421 zone)

EMBL: CP000529.PE129

CP000529.PE129       Location/Qualifiers
FT   CDS             143732..144829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0131"
FT                   /product="alanine racemase"
FT                   /EC_number="5.1.1.1"
FT                   /note="KEGG: pol:Bpro_0193 alanine racemase; TIGRFAM:
FT                   alanine racemase; PFAM: alanine racemase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35456"
FT                   /db_xref="GOA:A1VIH8"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VIH8"
FT                   /protein_id="ABM35456.1"
FT                   /translation="MPRPILATIHLAALSHNLARVRTAAPDAKVWAVVKANAYGHGIER
FT                   VFDALRSADGFALLDLDEARRLRALDWRGPILLLEGCFEARDLELCSRLGLWHTIHCQE
FT                   QIDMLAAHKTQLPHRVFLKMNTGMNRLGFTPERFRAAWIRLNALPQVDEISLMQHFPDA
FT                   DGPKGITAQLQAFDAVTHDLPGERTLSNSAAILRHTGALAGRSDWVRPGIVLYGSAPDF
FT                   PEHSASDWELQPTMTLSSRIIGLQTLAAGDTVGYGSSFVAEGPMRIGVVACGYADGYPR
FT                   HCPTGTPVLVNGVRTRMVGRVSMDMITVDLTPVPRAGMGSEVTLWGRASKGGAMLPIDE
FT                   VARAAGTVGYELMCAVAPRVPVAVD"
     MPRPILATIH LAALSHNLAR VRTAAPDAKV WAVVKANAYG HGIERVFDAL RSADGFALLD        60
     LDEARRLRAL DWRGPILLLE GCFEARDLEL CSRLGLWHTI HCQEQIDMLA AHKTQLPHRV       120
     FLKMNTGMNR LGFTPERFRA AWIRLNALPQ VDEISLMQHF PDADGPKGIT AQLQAFDAVT       180
     HDLPGERTLS NSAAILRHTG ALAGRSDWVR PGIVLYGSAP DFPEHSASDW ELQPTMTLSS       240
     RIIGLQTLAA GDTVGYGSSF VAEGPMRIGV VACGYADGYP RHCPTGTPVL VNGVRTRMVG       300
     RVSMDMITVD LTPVPRAGMG SEVTLWGRAS KGGAMLPIDE VARAAGTVGY ELMCAVAPRV       360
     PVAVD                                                                   365
//

If you have problems or comments...

PBIL Back to PBIL home page