(data stored in ACNUC7421 zone)

EMBL: CP000529.PE130

CP000529.PE130       Location/Qualifiers
FT   CDS             144826..145665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0132"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: Dmel_CG32611; CG32611 gene product from
FT                   transcript CG32611-RB"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35457"
FT                   /db_xref="GOA:A1VIH9"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIH9"
FT                   /protein_id="ABM35457.1"
FT                   /translation="MKNLSNWRSVRLLESRLEHDLRQRHVFWLHGLFIGLVTLGLTWGA
FT                   SHAQMLLGVESLALRYLVSLGLGYLGYLLMLRLWAGALVRQHRQRDGWGNLDGGWPGGE
FT                   GGGGSGSASARLPSLRSGEGGDFGGGGASGDFSGAVDAPGILESADAAGGAGKMVSGAL
FT                   EAAGSADEAAVVVVPVVAIFLIGCAVFFGAGSLVLMYFGWEALLAVAVELAFSYVSARV
FT                   AVRVVREGWLSAALRLTWKPLLGAVLCAVLLGATVDHFVPAAHSLPQALRLVSGPAR"
     MKNLSNWRSV RLLESRLEHD LRQRHVFWLH GLFIGLVTLG LTWGASHAQM LLGVESLALR        60
     YLVSLGLGYL GYLLMLRLWA GALVRQHRQR DGWGNLDGGW PGGEGGGGSG SASARLPSLR       120
     SGEGGDFGGG GASGDFSGAV DAPGILESAD AAGGAGKMVS GALEAAGSAD EAAVVVVPVV       180
     AIFLIGCAVF FGAGSLVLMY FGWEALLAVA VELAFSYVSA RVAVRVVREG WLSAALRLTW       240
     KPLLGAVLCA VLLGATVDHF VPAAHSLPQA LRLVSGPAR                              279
//

If you have problems or comments...

PBIL Back to PBIL home page