(data stored in ACNUC7421 zone)

EMBL: CP000529.PE132

CP000529.PE132       Location/Qualifiers
FT   CDS             146104..146532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0134"
FT                   /product="protein of unknown function DUF86"
FT                   /note="PFAM: protein of unknown function DUF86; KEGG:
FT                   neu:NE2225 protein of unknown function DUF86"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35459"
FT                   /db_xref="InterPro:IPR008201"
FT                   /db_xref="InterPro:IPR037038"
FT                   /db_xref="UniProtKB/TrEMBL:A1VII1"
FT                   /protein_id="ABM35459.1"
FT                   /translation="MADDVLINKAATIERCVRRAREEYDRDPATFATDFTRQDAAILNI
FT                   QRACEAALDMGQHLIRREKLGVPQSARDVFALLAQGGWINAALADGLKRMVGFRNIAVH
FT                   DYQALQLPITVAIIQKHLDEFLHYSQGVLLRDAGQAAT"
     MADDVLINKA ATIERCVRRA REEYDRDPAT FATDFTRQDA AILNIQRACE AALDMGQHLI        60
     RREKLGVPQS ARDVFALLAQ GGWINAALAD GLKRMVGFRN IAVHDYQALQ LPITVAIIQK       120
     HLDEFLHYSQ GVLLRDAGQA AT                                                142
//

If you have problems or comments...

PBIL Back to PBIL home page