(data stored in ACNUC7421 zone)

EMBL: CP000529.PE139

CP000529.PE139       Location/Qualifiers
FT   CDS             complement(152045..152521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0141"
FT                   /product="putative transposase of insertion sequence
FT                   ISRm10-1"
FT                   /note="KEGG: sme:SMb21046 putative transposase of insertion
FT                   sequence ISRm10-1"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35466"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:A1VII8"
FT                   /protein_id="ABM35466.1"
FT                   /translation="MAPTRGRSPRGQRCRGFAPAGHWRTTTFVCALSTQGLRAPLVLDG
FT                   PLNGPAFRAWVEQFLVPELRPSDIVVMDNLSAHKVAGIQAAIEQAGATVKYLPPYSPDF
FT                   NPIEQVFAKLKAMLRKTQARTVDALWSAIGQLLDRFGSAECERYVRHCGYCGSG"
     MAPTRGRSPR GQRCRGFAPA GHWRTTTFVC ALSTQGLRAP LVLDGPLNGP AFRAWVEQFL        60
     VPELRPSDIV VMDNLSAHKV AGIQAAIEQA GATVKYLPPY SPDFNPIEQV FAKLKAMLRK       120
     TQARTVDALW SAIGQLLDRF GSAECERYVR HCGYCGSG                               158
//

If you have problems or comments...

PBIL Back to PBIL home page