(data stored in ACNUC7421 zone)

EMBL: CP000529.PE143

CP000529.PE143       Location/Qualifiers
FT   CDS             complement(156232..157020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0145"
FT                   /product="P pilus assembly protein chaperone PapD-like
FT                   protein"
FT                   /note="KEGG: bur:Bcep18194_A4396 P pilus assembly protein
FT                   chaperone PapD-like"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35470"
FT                   /db_xref="GOA:A1VIJ2"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIJ2"
FT                   /protein_id="ABM35470.1"
FT                   /translation="MMLNALVHRSLCAGVLLAGMLGLPASSYAAGLSISPVVVEIDSPR
FT                   RAVAVTVTNQGDQAVTFQTEAMVWQQVNGVDQFEPTDELLVVPPIVEVPPNASQIFRVT
FT                   LHVPRPSPVERTYRLILEDVSEDQAPTGQASVAFKFAHNLPVMVAPSGNVSNAVRWKPC
FT                   PPEASATAASALAKPTTARSPEACVRLLNAGNRRVKVQTLTLTGDNWQQALPLKNGVNV
FT                   LAGAEREWRVPLQAGQTGALRGMQVNTARGETLQAEAGGF"
     MMLNALVHRS LCAGVLLAGM LGLPASSYAA GLSISPVVVE IDSPRRAVAV TVTNQGDQAV        60
     TFQTEAMVWQ QVNGVDQFEP TDELLVVPPI VEVPPNASQI FRVTLHVPRP SPVERTYRLI       120
     LEDVSEDQAP TGQASVAFKF AHNLPVMVAP SGNVSNAVRW KPCPPEASAT AASALAKPTT       180
     ARSPEACVRL LNAGNRRVKV QTLTLTGDNW QQALPLKNGV NVLAGAEREW RVPLQAGQTG       240
     ALRGMQVNTA RGETLQAEAG GF                                                262
//

If you have problems or comments...

PBIL Back to PBIL home page