(data stored in ACNUC7421 zone)

EMBL: CP000529.PE145

CP000529.PE145       Location/Qualifiers
FT   CDS             158095..159036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0147"
FT                   /product="branched chain amino acid aminotransferase
FT                   apoenzyme"
FT                   /EC_number="2.6.1.42"
FT                   /note="TIGRFAM: branched-chain amino acid aminotransferase;
FT                   PFAM: aminotransferase, class IV; KEGG: pol:Bpro_0203
FT                   branched-chain amino acid aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35472"
FT                   /db_xref="GOA:A1VIJ4"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005785"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR033939"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIJ4"
FT                   /protein_id="ABM35472.1"
FT                   /translation="MTPAAPSMENRDGKIWMDGQMVEWRDAKIHVLTHTLHYGCGAFEG
FT                   VRAYKMPDGGTAIFRLEEHTERLFNSAKILRMKIPFTPQEVMDAQLAVVRENKLESGYI
FT                   RPLTWIGSEKLGVSPKGNTIHLMVAAWTWGAYLGEEGMKRGIRVKTSSFTRHHVNITMI
FT                   HAKAVSNYTNSILANMEATDEGYDEALLLDPQGFASEGAGENLFIVRKGVVYTPDSSAG
FT                   ALNGITRNTVFSICKDLGIEIREKPITRDEIYISDEAFFSGTAAEVTPIRELDRIEIGS
FT                   GSRGPITEKIQAAFFDIVNGRNPEYASWLTRV"
     MTPAAPSMEN RDGKIWMDGQ MVEWRDAKIH VLTHTLHYGC GAFEGVRAYK MPDGGTAIFR        60
     LEEHTERLFN SAKILRMKIP FTPQEVMDAQ LAVVRENKLE SGYIRPLTWI GSEKLGVSPK       120
     GNTIHLMVAA WTWGAYLGEE GMKRGIRVKT SSFTRHHVNI TMIHAKAVSN YTNSILANME       180
     ATDEGYDEAL LLDPQGFASE GAGENLFIVR KGVVYTPDSS AGALNGITRN TVFSICKDLG       240
     IEIREKPITR DEIYISDEAF FSGTAAEVTP IRELDRIEIG SGSRGPITEK IQAAFFDIVN       300
     GRNPEYASWL TRV                                                          313
//

If you have problems or comments...

PBIL Back to PBIL home page