(data stored in ACNUC7421 zone)

EMBL: CP000529.PE153

CP000529.PE153       Location/Qualifiers
FT   CDS             complement(165477..166067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0155"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_3538 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35480"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIK2"
FT                   /protein_id="ABM35480.1"
FT                   /translation="MNKINSILALSASMCMLMNANGQALTSGATSAPVASSSAGNQDFY
FT                   QGITFNSPGETHQYIESGGTQTIKNVPSVAGPNLTTSNDTCMGSSSGSMNGPGFGVSIG
FT                   STWSDANCKLLKNSRELWNMGMKAAAMALMCTDAANRDALEMTGFECPQTSRNKKIAQQ
FT                   ASAVNPPSSGDQEHITDPYIRARMGLAALQAKN"
     MNKINSILAL SASMCMLMNA NGQALTSGAT SAPVASSSAG NQDFYQGITF NSPGETHQYI        60
     ESGGTQTIKN VPSVAGPNLT TSNDTCMGSS SGSMNGPGFG VSIGSTWSDA NCKLLKNSRE       120
     LWNMGMKAAA MALMCTDAAN RDALEMTGFE CPQTSRNKKI AQQASAVNPP SSGDQEHITD       180
     PYIRARMGLA ALQAKN                                                       196
//

If you have problems or comments...

PBIL Back to PBIL home page