(data stored in ACNUC7421 zone)

EMBL: CP000529.PE156

CP000529.PE156       Location/Qualifiers
FT   CDS             166913..167155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0158"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35483"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIK5"
FT                   /protein_id="ABM35483.1"
FT                   /translation="MFQSAGKTPVFDCDAIRFPVVQKLINIFLFMNKQEFLLCAVFFFS
FT                   LHGSNFLVHITVADAAVCAGLLRSIIIYCADSTTP"
     MFQSAGKTPV FDCDAIRFPV VQKLINIFLF MNKQEFLLCA VFFFSLHGSN FLVHITVADA        60
     AVCAGLLRSI IIYCADSTTP                                                    80
//

If you have problems or comments...

PBIL Back to PBIL home page