(data stored in ACNUC7421 zone)

EMBL: CP000529.PE157

CP000529.PE157       Location/Qualifiers
FT   CDS             167736..168044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0159"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35484"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIK6"
FT                   /protein_id="ABM35484.1"
FT                   /translation="MSAPWFSKPLGDGVWAYSLSNQARDAFEPLFVLAGRPLEMAVFTR
FT                   HQSAGRLHCEVTAYFSPAAATVAHVLDARPCGAPSRGNLDLLAGDPACWPVIFPDGE"
     MSAPWFSKPL GDGVWAYSLS NQARDAFEPL FVLAGRPLEM AVFTRHQSAG RLHCEVTAYF        60
     SPAAATVAHV LDARPCGAPS RGNLDLLAGD PACWPVIFPD GE                          102
//

If you have problems or comments...

PBIL Back to PBIL home page