(data stored in ACNUC7421 zone)

EMBL: CP000529.PE160

CP000529.PE160       Location/Qualifiers
FT   CDS             complement(170874..171479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0162"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: bcn:Bcen_3964
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35487"
FT                   /db_xref="GOA:A1VIK9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIK9"
FT                   /protein_id="ABM35487.1"
FT                   /translation="MSNEHTDVKQHILDTGRSIILGKGFSAVGLNEILSTAQVPKGSFY
FT                   HYFKSKEAFGEALVDGYVADYLAQVDRLLQDDGAPAAERLMRYWRSWMTPADSQSAECN
FT                   CLVVKLSGEVSDMSEAMRAALLRGTNLIIERLGNCIAQGLADGSLTGTLEAQHTALTLY
FT                   ELWLGAALLTKVRRERSALDAAMAATCSLLKLPQPVSA"
     MSNEHTDVKQ HILDTGRSII LGKGFSAVGL NEILSTAQVP KGSFYHYFKS KEAFGEALVD        60
     GYVADYLAQV DRLLQDDGAP AAERLMRYWR SWMTPADSQS AECNCLVVKL SGEVSDMSEA       120
     MRAALLRGTN LIIERLGNCI AQGLADGSLT GTLEAQHTAL TLYELWLGAA LLTKVRRERS       180
     ALDAAMAATC SLLKLPQPVS A                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page