(data stored in ACNUC7421 zone)

EMBL: CP000529.PE161

CP000529.PE161       Location/Qualifiers
FT   CDS             171564..172418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0163"
FT                   /product="protein of unknown function RIO1"
FT                   /note="PFAM: protein of unknown function RIO1; KEGG:
FT                   pol:Bpro_3868 protein of unknown function RIO1"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35488"
FT                   /db_xref="GOA:A1VIL0"
FT                   /db_xref="InterPro:IPR000687"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR018935"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIL0"
FT                   /protein_id="ABM35488.1"
FT                   /translation="MAGMKAPPRLQSLVEEGLIDTVVRQLMSGKEAMVYVVRCGDETRC
FT                   AKIYKEADQRSFRQAVDYTENRKVKNTRQARAMAKGTKFGRQASEAAWQSAEVDALYRL
FT                   ADAGVRVPQPHNFCDGVLLMELVTDAHGDAAPRLNDVDFTPEQARRHHATLITEVIRML
FT                   CAGIVHGDLSEFNILLAEDGPVIIDLPQAVDAAGNNHASRMLLRDVANLRNFFGRFAPD
FT                   LLTIDYGNEMWDLYQRGVLYPETVLTGHFRRKTGPVDVGGVLREIDDASAEEAARRMRM
FT                   AQS"
     MAGMKAPPRL QSLVEEGLID TVVRQLMSGK EAMVYVVRCG DETRCAKIYK EADQRSFRQA        60
     VDYTENRKVK NTRQARAMAK GTKFGRQASE AAWQSAEVDA LYRLADAGVR VPQPHNFCDG       120
     VLLMELVTDA HGDAAPRLND VDFTPEQARR HHATLITEVI RMLCAGIVHG DLSEFNILLA       180
     EDGPVIIDLP QAVDAAGNNH ASRMLLRDVA NLRNFFGRFA PDLLTIDYGN EMWDLYQRGV       240
     LYPETVLTGH FRRKTGPVDV GGVLREIDDA SAEEAARRMR MAQS                        284
//

If you have problems or comments...

PBIL Back to PBIL home page