(data stored in ACNUC7421 zone)

EMBL: CP000529.PE167

CP000529.PE167       Location/Qualifiers
FT   CDS             180176..180847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0169"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_0218 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35494"
FT                   /db_xref="InterPro:IPR025392"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIL6"
FT                   /protein_id="ABM35494.1"
FT                   /translation="MRLPSPITLGLAGLALLCGGAAVAQDIYSCVDARGRTITADRPIP
FT                   ECSDRTQRELSRNGLLKRQIGPSLTAHEQAAQDEKDRQAAEIRAREAEDKRRDRALLLR
FT                   YPTRAVHDQERTAALLQIDEVIKASIKRRGELADQRKAIASELEFYAKDLSRAPASLKR
FT                   RLEENEGSVAVQQKFIADQEQEKKRVNLRFDEELAKLKQLWPMVSPPIRPGASASKVGK
FT                   N"
     MRLPSPITLG LAGLALLCGG AAVAQDIYSC VDARGRTITA DRPIPECSDR TQRELSRNGL        60
     LKRQIGPSLT AHEQAAQDEK DRQAAEIRAR EAEDKRRDRA LLLRYPTRAV HDQERTAALL       120
     QIDEVIKASI KRRGELADQR KAIASELEFY AKDLSRAPAS LKRRLEENEG SVAVQQKFIA       180
     DQEQEKKRVN LRFDEELAKL KQLWPMVSPP IRPGASASKV GKN                         223
//

If you have problems or comments...

PBIL Back to PBIL home page