(data stored in ACNUC7421 zone)

EMBL: CP000529.PE168

CP000529.PE168       Location/Qualifiers
FT   CDS             complement(180938..182395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0170"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit B"
FT                   /EC_number="6.3.5.-"
FT                   /note="TIGRFAM: glutamyl-tRNA(Gln) amidotransferase, B
FT                   subunit; PFAM: GatB/Yqey domain protein; GatB N-terminal
FT                   region; GatB, central domain protein; KEGG: pol:Bpro_0219
FT                   glutamyl-tRNA(Gln) amidotransferase, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35495"
FT                   /db_xref="GOA:A1VIL7"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIL7"
FT                   /protein_id="ABM35495.1"
FT                   /translation="MSKTTKSLLVQGYEVVIGFETHTQLTTQSKLFSRAPIAFGAEPNT
FT                   QASAVDFALPGALPVMNKGAVQRAIEFGLAVNAHIAEKSIFARKNYFYPDLPKGYQISQ
FT                   FEIPVVQGGVVEFFLDGEKKSVRLVRAHLEEDAGKSLHEDFIGMSGIDLNRAGTPLLEI
FT                   VTEPDMRSTAEAVAYAKELHKIVTWIGICDGNMQEGSFRCDANVSVRKPGEPLGTRREI
FT                   KNLNSFKFMQQAMDYEVRWQIEQIEDGHEIQQATVLFDPDTGETRSMRSKEDAADYRYF
FT                   PDPDLPPLVIGRDWVEKTRSEMSELPRVMAARFVADYGLPEYDAGQLTQSKATAAYFEA
FT                   VATASKSPKLASNWVMGELSRRLNAEEKSIEASAVSALQLAALIGRIADGTIANNAARQ
FT                   VFDALWTGEGLDVDALIEAKGLKSMSDTGELETIIDGVLAANAKNVEEVKAGNAKAFNA
FT                   LVGQAMKATKGKANPAQVNELLKKKLG"
     MSKTTKSLLV QGYEVVIGFE THTQLTTQSK LFSRAPIAFG AEPNTQASAV DFALPGALPV        60
     MNKGAVQRAI EFGLAVNAHI AEKSIFARKN YFYPDLPKGY QISQFEIPVV QGGVVEFFLD       120
     GEKKSVRLVR AHLEEDAGKS LHEDFIGMSG IDLNRAGTPL LEIVTEPDMR STAEAVAYAK       180
     ELHKIVTWIG ICDGNMQEGS FRCDANVSVR KPGEPLGTRR EIKNLNSFKF MQQAMDYEVR       240
     WQIEQIEDGH EIQQATVLFD PDTGETRSMR SKEDAADYRY FPDPDLPPLV IGRDWVEKTR       300
     SEMSELPRVM AARFVADYGL PEYDAGQLTQ SKATAAYFEA VATASKSPKL ASNWVMGELS       360
     RRLNAEEKSI EASAVSALQL AALIGRIADG TIANNAARQV FDALWTGEGL DVDALIEAKG       420
     LKSMSDTGEL ETIIDGVLAA NAKNVEEVKA GNAKAFNALV GQAMKATKGK ANPAQVNELL       480
     KKKLG                                                                   485
//

If you have problems or comments...

PBIL Back to PBIL home page